PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_27706A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 376aa    MW: 42040.5 Da    PI: 8.2195
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_27706AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.51e-1064101846
                                HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                Ed++l + v+++G ++W t+ar ++  R + qc+ rw +
  Oropetium_20150105_27706A  64 EDDILTQMVNKHGLNNWQTVARAIP-DRNALQCRMRWKN 101
                                9************************.***********98 PP

2Myb_DNA-binding40.94.9e-13109151145
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                + +W+++E+++l++a++++G++ W    ++++ gRt + +k++w+
  Oropetium_20150105_27706A 109 KEAWSEQEELRLIRAHQLYGNK-WLQMVKHFP-GRTNYALKEHWR 151
                                579*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.2E-856105IPR001005SANT/Myb domain
PROSITE profilePS500909.04762103IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.4E-1962110IPR009057Homeodomain-like
SuperFamilySSF466894.49E-2463150IPR009057Homeodomain-like
PfamPF139216.7E-1563120No hitNo description
CDDcd001679.89E-1164103No hitNo description
PROSITE profilePS5129420.009104158IPR017930Myb domain
SMARTSM007171.2E-9108156IPR001005SANT/Myb domain
CDDcd001675.96E-9111151No hitNo description
Gene3DG3DSA:1.10.10.601.1E-16111158IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MEQNRDGISR RGVRCFIKAQ NIAMKQNRKR QMTIHARKMS TASRREAVQN ILKGPKADGH  60
QRKEDDILTQ MVNKHGLNNW QTVARAIPDR NALQCRMRWK NSLDPAINKE AWSEQEELRL  120
IRAHQLYGNK WLQMVKHFPG RTNYALKEHW RGPMKRKLDS YLASGLVEQV PDLHDDISSA  180
PDSKQSDTPN DNAELSERKQ TSPALPTSPK SKEVCSEQGG NADSSGECSD FTYVKGPARS  240
AEVSERIIAK SKQRATAKKK LDFLSTPVEL KVCTSAPSLQ SPLSKTEQMS PIVDKISPSD  300
VVQDDPPNAP LKFANTFLSV TTGNHSKDVC SSELETPDPC SLDIHEESIL DLLDMSYCDD  360
LMMDLPSFPH GGSFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23471601110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698304.11e-119PREDICTED: snRNA-activating protein complex subunit 4-like isoform X3
RefseqXP_012698306.11e-120PREDICTED: cell division cycle 5-like protein isoform X4
TrEMBLA0A0A9FY271e-139A0A0A9FY27_ARUDO; Uncharacterized protein
STRINGSi017903m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP142631723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.14e-39myb domain protein 3r-4